DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT4G31170

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001031758.1 Gene:AT4G31170 / 829245 AraportID:AT4G31170 Length:412 Species:Arabidopsis thaliana


Alignment Length:267 Identity:82/267 - (30%)
Similarity:140/267 - (52%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEF--------FASAEQKDIEKEVKQLSRVKHP 70
            :|..::.:......|::|.:.:..:..:.||:|..        .|.|.::..::||..|:.:|||
plant   126 IDLRKLHMGPAFAQGAFGKLYRGTYNGEDVAIKLLERSDSNPEKAQALEQQFQQEVSMLAFLKHP 190

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKP 135
            ||:...|.........::.|:|:|||:..||..:...|..|..|:..|...|.|:||:|   .:.
plant   191 NIVRFIGACIKPMVWCIVTEYAKGGSVRQFLTKRQNRAVPLKLAVMQALDVARGMAYVH---ERN 252

  Fly   136 LIHRDVKPLNLLLTNKGRNLKICDFGT--VADKSTMMTNNRGSAAWMAPEVFEGSKYTEKCDIFS 198
            .||||:|..|||: :..|::||.|||.  :..::..||...|:..|||||:.:...||:|.|::|
plant   253 FIHRDLKSDNLLI-SADRSIKIADFGVARIEVQTEGMTPETGTYRWMAPEMIQHRPYTQKVDVYS 316

  Fly   199 WAIVLWEVLSRKQPFK---GIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSM 260
            :.|||||:::...||:   .:..|:.:   :.:|.||.:...|...:.::||.||...||.||..
plant   317 FGIVLWELITGLLPFQNMTAVQAAFAV---VNRGVRPTVPADCLPVLGEIMTRCWDADPEVRPCF 378

  Fly   261 QYIVGVM 267
            ..||.::
plant   379 AEIVNLL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 79/257 (31%)
STKc_TAK1 25..275 CDD:270960 81/256 (32%)
AT4G31170NP_001031758.1 STKc_MAP3K-like 138..385 CDD:270901 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.