DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT3G50730

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_190642.2 Gene:AT3G50730 / 824237 AraportID:AT3G50730 Length:371 Species:Arabidopsis thaliana


Alignment Length:322 Identity:95/322 - (29%)
Similarity:168/322 - (52%) Gaps:45/322 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKL-VAVK-------EFFASAEQKDIEKEVKQLSRVKHP 70
            :|.:::.:.|.:|.|:|.:|.|.:.|::. ||||       .....|.:|..:|||..||::||.
plant    31 LDRNDVVVGEMIGEGAYSIVYKGLLRNQFPVAVKIMDPSTTSAVTKAHKKTFQKEVLLLSKMKHD 95

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKP 135
            ||:...| :..:....::.|..|||:|..|:|.:..| ..|..::|:|...:..:.::|:   ..
plant    96 NIVKFVG-ACIEPQLIIVTELVEGGTLQRFMHSRPGP-LDLKMSLSFALDISRAMEFVHS---NG 155

  Fly   136 LIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTM--MTNNRGSAAWMAPEVF---------EGSK 189
            :||||:.|.|||:|...:::|:.||| :|.:.|.  ||...|::.||||||.         |..:
plant   156 IIHRDLNPRNLLVTGDLKHVKLADFG-IAREETRGGMTCEAGTSKWMAPEVVYSPEPLRVGEKKE 219

  Fly   190 YTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVP 254
            |..|.||:|:|||||::::.::||..:.|:..:.:.:.:|.| |:||..|.....::.:||...|
plant   220 YDHKADIYSFAIVLWQLVTNEEPFPDVPNSLFVPYLVSQGRR-PILTKTPDVFVPIVESCWAQDP 283

  Fly   255 EDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPS 316
            :.||..:.|..::..:::                ::.:..|.||..  ||. .:.|||:..|
plant   284 DARPEFKEISVMLTNLLR----------------RMSSDSSIGTTL--PDG-EAYEGEMEES 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 84/263 (32%)
STKc_TAK1 25..275 CDD:270960 84/268 (31%)
AT3G50730NP_190642.2 TyrKc 36..292 CDD:197581 84/262 (32%)
STKc_MAP3K-like 42..296 CDD:270901 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.