DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT3G46930

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001327397.1 Gene:AT3G46930 / 823846 AraportID:AT3G46930 Length:515 Species:Arabidopsis thaliana


Alignment Length:289 Identity:86/289 - (29%)
Similarity:152/289 - (52%) Gaps:20/289 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ASLDALQAAYVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDI------EK--- 59
            :|...|:...:|.|:::..::..||.|..:....:..|.||:|...|..:..||      ||   
plant   186 SSAGVLEECLIDVSKLSYGDRFAHGKYSQIYHGEYEGKAVALKIITAPEDSDDIFLGARLEKEFI 250

  Fly    60 -EVKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAE 123
             |...|||:.|||::...|:::   ...:|.|:...|||.::||...:.:..|...:.:....|:
plant   251 VEATLLSRLSHPNVVKFVGVNT---GNCIITEYVPRGSLRSYLHKLEQKSLPLEQLIDFGLDIAK 312

  Fly   124 GLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKS--TMMTNNRGSAAWMAPEVFE 186
            |:.|:|:   :.::|:|:||.|:|:.| ..:|||.|||...::.  .::.:|.|:..||||||.:
plant   313 GMEYIHS---REIVHQDLKPENVLIDN-DFHLKIADFGIACEEEYCDVLGDNIGTYRWMAPEVLK 373

  Fly   187 GSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWK-IYKGERPPLLTTCPKRIEDLMTACW 250
            ...:..|||::|:.::|||:::...|::.:..|..|.:. |||..||.:.|.||..:::|:..||
plant   374 RIPHGRKCDVYSFGLLLWEMVAGALPYEEMKFAEQIAYAVIYKKIRPVIPTDCPAAMKELIERCW 438

  Fly   251 KTVPEDRPSMQYIVGVMHEIVKDYTGADK 279
            .:..:.||....||.|:....|..|...|
plant   439 SSQTDKRPEFWQIVKVLEHFKKSLTSEGK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 76/257 (30%)
STKc_TAK1 25..275 CDD:270960 80/262 (31%)
AT3G46930NP_001327397.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.