DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and ATN1

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_189393.1 Gene:ATN1 / 822378 AraportID:AT3G27560 Length:356 Species:Arabidopsis thaliana


Alignment Length:361 Identity:102/361 - (28%)
Similarity:169/361 - (46%) Gaps:53/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEK-------EVKQLSRVKHPN 71
            ||...:.:..|:|.|::..|.:..:|::.||:|........::|.|       |:..||:|:|.|
plant    21 VDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREIAMLSKVQHKN 85

  Fly    72 IIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPL 136
            ::...| :..:....::.|...||:|..:|.........:..|:.:|...|..:..||:   ..:
plant    86 LVKFIG-ACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIARAMECLHS---HGI 146

  Fly   137 IHRDVKPLNLLLTNKGRNLKICDFGTVADKS--TMMTNNRGSAAWMAPEVF------EGSK--YT 191
            ||||:||.||:|:...:.:|:.|||...::|  .|||...|:..|||||::      :|.|  |.
plant   147 IHRDLKPENLILSADHKTVKLADFGLAREESLTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYN 211

  Fly   192 EKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPED 256
            .|.|.:|:||||||::..|.||:|:.|........:|..||. ....|..:|.::|:|||..|.:
plant   212 HKVDAYSFAIVLWELILNKLPFEGMSNLQAAYAAAFKNLRPS-AEDLPGDLEMIVTSCWKEDPNE 275

  Fly   257 RPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDS--LSSQEGELSPSSTQ 319
            ||:...|:.::             |.|       :|..|...:...|:.  .||:...|||.|  
plant   276 RPNFTEIIQML-------------LRY-------LTTVSAPQIIPPPNRRVFSSENIVLSPES-- 318

  Fly   320 LTPTTAANANVNAIAISKTTTSSMTENTSSTSSDIT 355
              |.|.:..:|....:|:.|.     ||:.:|...|
plant   319 --PGTCSLMSVRDGDVSRQTV-----NTADSSEKQT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 79/261 (30%)
STKc_TAK1 25..275 CDD:270960 79/266 (30%)
ATN1NP_189393.1 STKc_MAP3K-like 32..286 CDD:270901 79/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.