DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT3G01490

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_186798.1 Gene:AT3G01490 / 821136 AraportID:AT3G01490 Length:411 Species:Arabidopsis thaliana


Alignment Length:287 Identity:83/287 - (28%)
Similarity:138/287 - (48%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK--EFFASAEQKDIE---------KEVKQLSRV 67
            :|.|::.::..:..|::|.|.:.::..:.||||  ::.....:.|.|         :||....::
plant   103 IDPSKLIIKSVIARGTFGTVHRGIYDGQDVAVKLLDWGEEGHRSDAEIASLRAAFTQEVAVWHKL 167

  Fly    68 KHPNII----ALHGISSYQQAT------------YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMS 116
            .|||:.    |..|.|.....|            .:::|:..||:|.:||....:...:....:.
plant   168 DHPNVTKFIGAAMGTSEMSIQTENGQMGMPSNVCCVVVEYCPGGALKSFLIKTRRRKLAFKVVIQ 232

  Fly   117 WARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV---ADKSTMMTNNRGSAA 178
            .:...|.||:|||:   :.::|||||..|:|| :|.|.|||.|||..   |.....||...|:..
plant   233 LSLDLARGLSYLHS---QKIVHRDVKTENMLL-DKSRTLKIADFGVARLEASNPNDMTGETGTLG 293

  Fly   179 WMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIE 243
            :|||||..||.|..|||::|:.|.|||:.....|:..:..:......:.:..||.:...||..:.
plant   294 YMAPEVLNGSPYNRKCDVYSFGICLWEIYCCDMPYPDLSFSEVTSAVVRQNLRPEIPRCCPSSLA 358

  Fly   244 DLMTACWKTVPEDRPSMQYIVGVMHEI 270
            ::|..||...||.||.|:.:|.::..|
plant   359 NVMKRCWDANPEKRPEMEEVVAMLEAI 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 79/274 (29%)
STKc_TAK1 25..275 CDD:270960 81/276 (29%)
AT3G01490NP_186798.1 STKc_MAP3K-like 114..382 CDD:270901 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D635654at2759
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.