DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and AT2G24360

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_565568.1 Gene:AT2G24360 / 816972 AraportID:AT2G24360 Length:411 Species:Arabidopsis thaliana


Alignment Length:288 Identity:86/288 - (29%)
Similarity:146/288 - (50%) Gaps:35/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK------------EFFASAEQKDIEKEVKQLSR 66
            :|..::.:......|::|.:.|..:..:.||:|            :|.    ::..::||..|:.
plant   125 IDLRKLNMGPAFAQGAFGKLYKGTYNGEDVAIKILERPENSPEKAQFM----EQQFQQEVSMLAN 185

  Fly    67 VKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAM 131
            :|||||:...|.........::.|:|:|||:..||..:...|..|..|:..|...|.|:||:|. 
plant   186 LKHPNIVRFIGACRKPMVWCIVTEYAKGGSVRQFLTRRQNRAVPLKLAVKQALDVARGMAYVHG- 249

  Fly   132 TPKPLIHRDVKPLNLLLTNKGRNLKICDFGT--VADKSTMMTNNRGSAAWMAPEVFEGSKYTEKC 194
              :..||||:|..|||: :..:::||.|||.  :..::..||...|:..|||||:.:...|.:|.
plant   250 --RNFIHRDLKSDNLLI-SADKSIKIADFGVARIEVQTEGMTPETGTYRWMAPEMIQHRAYNQKV 311

  Fly   195 DIFSWAIVLWEVLSRKQPFK---GIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPED 256
            |::|:.|||||:::...||:   .:..|:.:   :.:|.||.:...|...:.|:||.||...||.
plant   312 DVYSFGIVLWELITGLLPFQNMTAVQAAFAV---VNRGVRPTVPNDCLPVLSDIMTRCWDANPEV 373

  Fly   257 RPSMQYIVGVMH----EIVKDYTGADKA 280
            ||....:|.::.    ||:   |.|.||
plant   374 RPCFVEVVKLLEAAETEIM---TTARKA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 78/261 (30%)
STKc_TAK1 25..275 CDD:270960 81/270 (30%)
AT2G24360NP_565568.1 STKc_MAP3K-like 137..384 CDD:270901 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.