DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Kin3

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_565408.1 Gene:Kin3 / 816227 AraportID:AT2G17220 Length:414 Species:Arabidopsis thaliana


Alignment Length:354 Identity:107/354 - (30%)
Similarity:159/354 - (44%) Gaps:74/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLDALQAAYVDF-SEITLREKVGHGSYGVVCKAVWRDK---------LVAVKEFFASAEQ--KDI 57
            ||..|:|:..:| ||..|    |.|.:|.|.|....||         ::|||:..|.:.|  ::.
plant    76 SLAELRASTRNFRSENVL----GEGGFGKVFKGWLEDKTPGKQSNGTVIAVKKLNAESFQGFEEW 136

  Fly    58 EKEVKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGK---VKPAYSLAHAMSW-- 117
            :.||..|.||.|||::.|.|.....:...|:.|:.:.|||.|.|..|   |:|       :||  
plant   137 QCEVNFLGRVSHPNLVKLLGYCLEGEELLLVYEYMQKGSLENHLFRKGSAVQP-------LSWEI 194

  Fly   118 ----ARQCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTV-----ADKSTMMTNN 173
                |...|:|||:||| :.|.:|:||.|..|:|| :...|.||.|||..     |.:|.:.|..
plant   195 RLKIAIGAAKGLAFLHA-SEKQVIYRDFKASNILL-DGSYNAKISDFGLAKLGPSASQSHITTRV 257

  Fly   174 RGSAAWMAPE-VFEGSKYTEKCDIFSWAIVLWEVLS---RKQPFKGIDNAYTIQW-KIYKGERPP 233
            .|:..:.||| |..|..|. |.|::.:.:||.|:|:   ...|.:........:| |.:..||..
plant   258 MGTHGYAAPEYVATGHLYV-KSDVYGFGVVLAEILTGLHALDPTRPTGQHNLTEWIKPHLSERRK 321

  Fly   234 LLTTCPKRIE------------DLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFV 286
            |.:....|:|            .|...|....|::||||:.:|..: |:::  ...:|.||..  
plant   322 LRSIMDPRLEGKYPFKSAFRVAQLALKCLGPEPKNRPSMKEVVESL-ELIE--AANEKPLERR-- 381

  Fly   287 NQQIVTKESDGTVAAQPDSLSSQEGELSP 315
                       |..|.| |:..|:|...|
plant   382 -----------TTRASP-SIRQQQGHYRP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 88/286 (31%)
STKc_TAK1 25..275 CDD:270960 89/291 (31%)
Kin3NP_565408.1 STYKc 90..367 CDD:214568 90/290 (31%)
STKc_IRAK 93..370 CDD:270968 90/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.