DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Mlkl

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001297542.1 Gene:Mlkl / 74568 MGIID:1921818 Length:472 Species:Mus musculus


Alignment Length:243 Identity:57/243 - (23%)
Similarity:105/243 - (43%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVKQLSRVKHPNIIALHGISSYQQAT----YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQ 120
            |:|.:.:...|||:.:.||...|...    .::||:.|.|:|...|..:.....|:...:  ..:
Mouse   239 EIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLL--VLR 301

  Fly   121 CAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDF--------------GTVADKSTMMT 171
            .|.||..||   ....:||::...:.|:.. |..:|:..|              .|.|::|:   
Mouse   302 AARGLYRLH---HSETLHRNISSSSFLVAG-GYQVKLAGFELSKTQNSISRTAKSTKAERSS--- 359

  Fly   172 NNRGSAAWMAPEVFEG--SKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPL 234
                |..:::||..:.  ..|..|.:|:|:.|||||:.:.|.||:|.|:....:......::.|:
Mouse   360 ----STIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPV 420

  Fly   235 LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALE 282
            ...||:.:.:::..|....|..|||:.         .:..:|.::.||
Mouse   421 GQDCPELLREIINECRAHEPSQRPSVD---------GRSLSGRERILE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 54/223 (24%)
STKc_TAK1 25..275 CDD:270960 54/234 (23%)
MlklNP_001297542.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000250|UniProtKB:Q8NB16 1..143
PHA02988 198..446 CDD:165291 53/219 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.