DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and PBK

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001265874.1 Gene:PBK / 55872 HGNCID:18282 Length:333 Species:Homo sapiens


Alignment Length:297 Identity:76/297 - (25%)
Similarity:123/297 - (41%) Gaps:61/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EKVGHGSYGV-----------VCKAVWRDKLV--AVKEFFASAEQKDIEKEVKQLSRVKHPNIIA 74
            :|:|.|: ||           :..:.|..|.:  ...:.:.|..||.:..|.|.|..:.||||: 
Human    36 QKLGFGT-GVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIV- 98

  Fly    75 LHGISSYQQAT----YLIMEFAEGGSLHNFLHGKVKPA---YSLAHAMSWARQCAEGLAYLHAMT 132
              |..::.:|.    .|.||:....||::.:..:.|.:   :..|..:..|...|.||.|||  .
Human    99 --GYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLH--Q 159

  Fly   133 PKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNR-----------------GSAAWM 180
            .|.|:|.|:|..|:::......:||||.|........||...                 |:..|.
Human   160 EKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTAPAFITILLVSVTDPEACYIGTEPWK 224

  Fly   181 APE-VFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYK-------------GER 231
            ..| |.|....|:|.|||::.:.|||:::...|...:.|....:.|.:.             |.|
Human   225 PKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTR 289

  Fly   232 PPL----LTTCPKRIEDLMTACWKTVPEDRPSMQYIV 264
            ||:    |....:::.:|.:.|....|:||||..:||
Human   290 PPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 74/295 (25%)
STKc_TAK1 25..275 CDD:270960 75/295 (25%)
PBKNP_001265874.1 PKc_TOPK 32..332 CDD:270903 76/297 (26%)
Pkinase 34..327 CDD:278497 76/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.