DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and RIPK4

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_065690.2 Gene:RIPK4 / 54101 HGNCID:496 Length:784 Species:Homo sapiens


Alignment Length:406 Identity:117/406 - (28%)
Similarity:190/406 - (46%) Gaps:81/406 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DFSEITLREKVGHGSYGVVCK---AVWRDKLVAVK----EFFASAEQKDIEKEVKQLSRVKHPNI 72
            |..|.|..||||.|.:|.|.|   ..|:..| |:|    ......|:.::.:|.|::...|...|
Human    18 DAGEFTGWEKVGSGGFGQVYKVRHVHWKTWL-AIKCSPSLHVDDRERMELLEEAKKMEMAKFRYI 81

  Fly    73 IALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKP---AYSLAHAMSWARQCAEGLAYLHAMTPK 134
            :.::||.  ::...|:||:.|.|||...|..:..|   .:.:.|      :.|.|:.:||.|.| 
Human    82 LPVYGIC--REPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIH------ETAVGMNFLHCMAP- 137

  Fly   135 PLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNR--------GSAAWMAPE-VFEGSK- 189
            ||:|.|:||.|:|| :...::||.|||..  |...::::.        |:.|::.|| :.|.|: 
Human   138 PLLHLDLKPANILL-DAHYHVKISDFGLA--KCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRL 199

  Fly   190 YTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKR------IEDLMTA 248
            :..|.|::|:|||:|.||::|:||....|...|..|:.||.||.|...|..|      :..||..
Human   200 FDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQR 264

  Fly   249 CWKTVPEDRPSMQYIVGVMHEI-------VKDYTGAD-------------------KALEYTFVN 287
            ||:..|..||:.|.|.....::       ||: |..|                   :|...||.|
Human   265 CWQGDPRVRPTFQEITSETEDLCEKPDDEVKE-TAHDLDVKSPPEPRSEVVPARLKRASAPTFDN 328

  Fly   288 QQIVTKESDGTVAAQPDSLSSQ--EG--ELSPSSTQ-LTPTTAANANVNAI-----AISKTTTSS 342
            ...:::     :.:|.||..||  ||  |||.||:: ..|::.:...::.:     |.|...:.|
Human   329 DYSLSE-----LLSQLDSGVSQAVEGPEELSRSSSESKLPSSGSGKRLSGVSSVDSAFSSRGSLS 388

  Fly   343 MTENTSSTSSDITPTN 358
            ::.....::||:..|:
Human   389 LSFEREPSTSDLGTTD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 87/270 (32%)
STKc_TAK1 25..275 CDD:270960 87/282 (31%)
RIPK4NP_065690.2 STKc_RIP4_like 25..290 CDD:270927 87/277 (31%)
STYKc 26..279 CDD:214568 86/265 (32%)
ANK 413..524 CDD:238125
ANK repeat 437..468 CDD:293786
Ank_2 442..534 CDD:289560
ANK repeat 470..501 CDD:293786
ANK 471..589 CDD:238125
ANK repeat 503..534 CDD:293786
Ank_2 508..600 CDD:289560
ANK repeat 536..567 CDD:293786
ANK repeat 569..600 CDD:293786
ANK 598..723 CDD:238125
ANK repeat 603..634 CDD:293786
Ank_2 608..699 CDD:289560
ANK repeat 636..667 CDD:293786
ANK repeat 669..699 CDD:293786
Ank_2 674..764 CDD:289560
ANK 729..>764 CDD:238125
ANK repeat 734..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.