DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Ilk

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_525001.2 Gene:Ilk / 53573 FlyBaseID:FBgn0028427 Length:448 Species:Drosophila melanogaster


Alignment Length:305 Identity:72/305 - (23%)
Similarity:123/305 - (40%) Gaps:65/305 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATASLDALQAAY--VDFSEITLREKVGHGSYGVVCKAVWRD-----KLVAVKEFFASAEQKDIE 58
            :.|.|.||..:.:  :...::.|..|:.....|...:..|:.     |::||:: ......:|..
  Fly   172 LKTRSRDATLSRFKGISMGDLDLHTKLSVTPSGETWRGRWQKNDVVAKILAVRQ-CTPRISRDFN 235

  Fly    59 KEVKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAE 123
            :|..:|....||||:.:.|..:.......|.:|....||.:.|||........:.|:|:|...|.
  Fly   236 EEFPKLRIFSHPNILPIIGACNSPPNLVTISQFMPRSSLFSLLHGATGVVVDTSQAVSFALDVAR 300

  Fly   124 GLAYLHAMTP-KPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSA---------- 177
            |:|:||::.. .|..|     ||             ....:.|.......|.|.|          
  Fly   301 GMAFLHSLERIIPTYH-----LN-------------SHHVMIDDDLTARINMGDAKFSFQEKGRI 347

  Fly   178 ---AWMAPEVF---EGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQW-------KI-YK 228
               |||:||..   :..:..|.||::|:||::||:.:|:.||        .:|       || .:
  Fly   348 YQPAWMSPETLQRKQADRNWEACDMWSFAILIWELTTREVPF--------AEWSPMECGMKIALE 404

  Fly   229 GER---PPLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270
            |.|   ||..:|   .:..|::.|....|..||....:|.::.::
  Fly   405 GLRVKIPPGTST---HMAKLISICMNEDPGKRPKFDMVVPILEKM 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 67/277 (24%)
STKc_TAK1 25..275 CDD:270960 66/279 (24%)
IlkNP_525001.2 ANK 28..140 CDD:238125
ANK repeat 33..64 CDD:293786
Ank_2 38..130 CDD:289560
ANK repeat 66..97 CDD:293786
ANK repeat 99..130 CDD:293786
PK_ILK 196..446 CDD:270959 67/279 (24%)
STYKc 204..443 CDD:214568 66/268 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.