DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Tnni3k

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_796040.3 Gene:Tnni3k / 435766 MGIID:2443276 Length:834 Species:Mus musculus


Alignment Length:422 Identity:116/422 - (27%)
Similarity:190/422 - (45%) Gaps:77/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFAS--AEQKDIE---KEVKQLSRVKHPNI 72
            ::..|||...|.:|.||:|.|.|...|:|:||:|.:.|:  ..:.|::   :||..|.::.||.:
Mouse   456 HLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCV 520

  Fly    73 IALHGISSYQQATY-LIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPL 136
            :...|......:.: ::.::..||||.:.|| :.|....|...:..|...|:|:.|||::| :|:
Mouse   521 VQFVGACLDDPSQFAIVTQYISGGSLFSLLH-EQKRILDLQSKLIIAVDVAKGMEYLHSLT-QPI 583

  Fly   137 IHRDVKPLNLLLTNKGRNLKICDFGTVADKSTM----MTNNRGSAAWMAPEVF-EGSKYTEKCDI 196
            ||||:...|:||...|..: :.|||......::    ||...|:..||||||| :.::||.|.|:
Mouse   584 IHRDLNSHNILLYEDGHAV-VADFGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADV 647

  Fly   197 FSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQ 261
            ||:|:.|||:|:.:.||..:..|.......|...|||:..:.||.|..|:...|...||.||...
Mouse   648 FSYALCLWELLTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLMRGWNACPEGRPEFS 712

  Fly   262 YIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQ---LTPT 323
            .:|              :.||....|.::::..|           |:..|.|||||:.   |:..
Mouse   713 EVV--------------RKLEECLCNVELMSPAS-----------SNSSGSLSPSSSSDCLLSRG 752

  Fly   324 TAANANVNAI--------AISKTTTSSMTENTSSTSSDITPTNSGQLDNNPLFYMVTNRWDAIPE 380
            ....::|.|:        |::..:.:...::..      |.||.|                 :..
Mouse   753 GPGRSHVAALRSRFELEYALNARSYTGWPQSVG------THTNPG-----------------LSL 794

  Fly   381 EESNE----SRNDSFNLTSSAEATQRLETIRN 408
            ||.|.    |..|.:...|...:...|.:.||
Mouse   795 EEMNRGAQYSAVDKYGYVSDPMSPMHLHSRRN 826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 85/255 (33%)
STKc_TAK1 25..275 CDD:270960 84/260 (32%)
Tnni3kNP_796040.3 ANK repeat 66..98 CDD:293786
ANK 1 66..96
Ank_2 71..164 CDD:289560
ANK 99..220 CDD:238125
ANK repeat 100..131 CDD:293786
ANK 2 100..129
ANK 3 133..162
ANK repeat 134..164 CDD:293786
Ank_2 138..231 CDD:289560
ANK 161..289 CDD:238125
ANK repeat 166..197 CDD:293786
ANK 4 166..195
ANK repeat 199..231 CDD:293786
ANK 5 199..229
ANK 228..359 CDD:238125
ANK 6 233..262
Ank_4 237..286 CDD:290365
ANK repeat 268..301 CDD:293786
ANK 7 268..297
Ank_2 273..368 CDD:289560
ANK repeat 303..336 CDD:293786
ANK 8 303..334
ANK 333..>400 CDD:238125
ANK repeat 338..368 CDD:293786
ANK 9 338..367
Ank_4 339..400 CDD:290365
ANK 10 380..409
TyrKc 462..718 CDD:197581 86/272 (32%)
PKc_TNNI3K 468..721 CDD:270966 86/269 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..834 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.