DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and MOS

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_005363.1 Gene:MOS / 4342 HGNCID:7199 Length:346 Species:Homo sapiens


Alignment Length:287 Identity:73/287 - (25%)
Similarity:138/287 - (48%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFAS-----AEQKDIEKEVKQLSRVKHPNII 73
            :|:.::.|.:::|.|.:|.|.||.:|...||:|:....     |.::....|: .::|::|.||:
Human    55 IDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAEL-NVARLRHDNIV 118

  Fly    74 ALHGISSYQQA-----TYLIMEFAEGGSLHNFLHG--------------KVKPAYSLAHAMSWAR 119
            .:...|:...|     ..:||||....:||..::|              :.....||...:.::.
Human   119 RVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSL 183

  Fly   120 QCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFG---TVADKSTMMTNN---RGSAA 178
            ....||.:||:.:   ::|.|:||.|:|::.:. ..||.|||   .:.|.....|.:   .|:..
Human   184 DVVNGLLFLHSQS---IVHLDLKPANILISEQD-VCKISDFGCSEKLEDLLCFQTPSYPLGGTYT 244

  Fly   179 WMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLT-----TC 238
            ..|||:.:|...|.|.||:|:||.||::.:::.|:.| :..:.:...:....||.|..     :.
Human   245 HRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSG-ERQHILYAVVAYDLRPSLSAAVFEDSL 308

  Fly   239 P-KRIEDLMTACWKTVPEDRPSMQYIV 264
            | :|:.|::..||:.....|||.:.::
Human   309 PGQRLGDVIQRCWRPSAAQRPSARLLL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 72/280 (26%)
STKc_TAK1 25..275 CDD:270960 71/276 (26%)
MOSNP_005363.1 STKc_Mos 56..338 CDD:270881 73/286 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.