DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and MAP3K11

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_002410.1 Gene:MAP3K11 / 4296 HGNCID:6850 Length:847 Species:Homo sapiens


Alignment Length:342 Identity:110/342 - (32%)
Similarity:167/342 - (48%) Gaps:66/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FSEITLREKVGHGSYGVVCKAVWRDKLVAVK--------EFFASAEQKDIEKEVKQLSRVKHPNI 72
            |.|:.|.|.:|.|.:|.|.:..||.:|||||        :...:||  .:.:|.:..:.:.||||
Human   114 FQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAE--SVRQEARLFAMLAHPNI 176

  Fly    73 IALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLI 137
            |||..:...:....|:||:|.||.|...|.|:..|.:.|   ::||.|.|.|:.|||.....|:|
Human   177 IALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVL---VNWAVQIARGMHYLHCEALVPVI 238

  Fly   138 HRDVKPLNLLLTN-------KGRNLKICDFGTVAD--KSTMMTNNRGSAAWMAPEVFEGSKYTEK 193
            |||:|..|:||..       :.:.|||.|||...:  |:|.| :..|:.|||||||.:.|.:::.
Human   239 HRDLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQM-SAAGTYAWMAPEVIKASTFSKG 302

  Fly   194 CDIFSWAIVLWEVLSRKQPFKGID----------NAYTIQWKIYKGERPPLLTTCPKRIEDLMTA 248
            .|::|:.::|||:|:.:.|::|||          |..|:          |:.:|||:....||..
Human   303 SDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTL----------PIPSTCPEPFAQLMAD 357

  Fly   249 CWKTVPEDRPSMQYIV--------GVMHEIVKDYTGADKALEYTFVNQQIVTK-ESDGTVAAQPD 304
            ||...|..||....|:        .|:.|:.:|          :|.:.|...| |..|..    |
Human   358 CWAQDPHRRPDFASILQQLEALEAQVLREMPRD----------SFHSMQEGWKREIQGLF----D 408

  Fly   305 SLSSQEGELSPSSTQLT 321
            .|.::|.||.....:||
Human   409 ELRAKEKELLSREEELT 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 92/271 (34%)
STKc_TAK1 25..275 CDD:270960 94/284 (33%)
MAP3K11NP_002410.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 11..38
SH3_MLK1-3 45..102 CDD:212992
STKc_MLK3 113..379 CDD:271049 95/280 (34%)
STYKc 117..376 CDD:214568 93/274 (34%)
Leucine-zipper 1 403..424 6/24 (25%)
Leucine-zipper 2 438..459
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 655..847
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.