DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and MAP3K10

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_011525283.1 Gene:MAP3K10 / 4294 HGNCID:6849 Length:962 Species:Homo sapiens


Alignment Length:357 Identity:112/357 - (31%)
Similarity:169/357 - (47%) Gaps:71/357 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATASLDALQAAYVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEK------- 59
            |.|.|...|.  :.|.|:.|.|.:|.|.:|.|.:|:||.:.||||     |.:.|.||       
Human    83 APAGLQLPQE--IPFHELQLEEIIGVGGFGKVYRALWRGEEVAVK-----AARLDPEKDPAVTAE 140

  Fly    60 ----EVKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQ 120
                |.:....::|||||||.|.........|:||:|.||:|...|.|:..|.:.|   ::||.|
Human   141 QVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGGALSRVLAGRRVPPHVL---VNWAVQ 202

  Fly   121 CAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRN-------LKICDFGTVAD--KSTMMTNNRGS 176
            .|.|:.|||...|.|:||||:|.:|:|:.....|       |||.|||...:  |:|.| :..|:
Human   203 VARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKM-SAAGT 266

  Fly   177 AAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERP-PLLTTCPK 240
            .|||||||...|.:::..|::|:.::|||:|:.:.|::.|| |..:.:.:...:.. |:.:|||:
Human   267 YAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREID-ALAVAYGVAMNKLTLPIPSTCPE 330

  Fly   241 RIEDLMTA--------CWKTVPEDRPS----------------MQYIVGVMHEIVKDYTGADKAL 281
            ....|:..        ||...|..||.                .|..:...|.:.:|:     .|
Human   331 PFARLLEGEPGPRDEECWDPDPHGRPDFGSILKRLEVIEQSALFQMPLESFHSLQEDW-----KL 390

  Fly   282 EYTFVNQQIVTKESDGTVAAQPDSLSSQEGEL 313
            |...:...:.|||.:         |.|:|.||
Human   391 EIQHMFDDLRTKEKE---------LRSREEEL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 94/289 (33%)
STKc_TAK1 25..275 CDD:270960 94/294 (32%)
MAP3K10XP_011525283.1 SH3_MLK1-3 20..76 CDD:212992
TyrKc 98..365 CDD:197581 93/276 (34%)
PKc_like 103..368 CDD:304357 91/274 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.