DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Takl2

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_651090.2 Gene:Takl2 / 42692 FlyBaseID:FBgn0039015 Length:281 Species:Drosophila melanogaster


Alignment Length:273 Identity:126/273 - (46%)
Similarity:175/273 - (64%) Gaps:4/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNIIALHGI 78
            |.:.||..:|.:|.|.||.|.:||||::.:|:|......|.|.||:|:.||::..|.||:.|:|.
  Fly     8 VPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGT 72

  Fly    79 SSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKP 143
            |.::....|:|||.:||||.:|||.|.||:||.|||.:||.|.|:|:||||.|.||.:||||:||
  Fly    73 SRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIKP 137

  Fly   144 LNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWMAPEVFEGSKYTEKCDIFSWAIVLWEVLS 208
            ||.||..||..|||||||||.|.|..::.|.|:..:.||||.:|:|..||||::||||..||:||
  Fly   138 LNTLLCEKGLKLKICDFGTVVDLSQSISCNAGTCRYKAPEVLQGNKPDEKCDVYSWAITFWEILS 202

  Fly   209 RKQPFKGIDNAYTIQWKIYKGERPPL---LTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEI 270
            ||:||:..:..:.:...|.:||||.|   ::.||..|..|:.|.|......|.||:.|...|..|
  Fly   203 RKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIVALLYASWDPDISKRFSMELISQSMGRI 267

  Fly   271 VKDYTGADKALEY 283
            :.: .|:...|::
  Fly   268 LSE-AGSIPPLDF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 119/247 (48%)
STKc_TAK1 25..275 CDD:270960 120/252 (48%)
Takl2NP_651090.2 S_TKc 14..258 CDD:214567 117/243 (48%)
PKc_like 19..268 CDD:304357 119/248 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444228
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.