DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and ripk4

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_998243.1 Gene:ripk4 / 406351 ZFINID:ZDB-GENE-040426-2042 Length:820 Species:Danio rerio


Alignment Length:461 Identity:123/461 - (26%)
Similarity:201/461 - (43%) Gaps:104/461 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DFSEITLREKVGHGSYGVVCKA---VWRDKLVAVK----EFFASAEQKDIEKEVKQLSRVKHPNI 72
            |.||....||:|.|.:|.|.|.   .|:..| |:|    ......|:.::.:|.|::...|...|
Zfish    18 DASEFGSWEKIGSGGFGQVYKVRHMQWKTWL-AIKCPPSLHSDDKERAELLEEAKKMEAAKFRYI 81

  Fly    73 IALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKP---AYSLAHAMSWARQCAEGLAYLHAMTPK 134
            :.::|:.|..|.  |:||:.|.|||...|..:..|   .:.:.|      :.|.|:.:||.|.| 
Zfish    82 LPVYGVCSDPQG--LVMEYMETGSLETLLATEPLPWELRFRIIH------ETAVGMNFLHCMNP- 137

  Fly   135 PLIHRDVKPLNLLLTNKGRNLKICDFGT------VADKSTMMTNNRGSAAWMAPE-VFEGSKYTE 192
            ||:|.|:||.|:|| :...::||.|||.      ..|.........|:.|::.|| :.|..:.::
Zfish   138 PLLHLDLKPANILL-DAHYHIKISDFGLARWNGFARDDDISRDGFCGTIAYLPPERIIEKDRVSD 201

  Fly   193 -KCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIE------DLMTACW 250
             |.|::|::||:|.:|::|:|::|.:|...|..|:.||.||.|......|.:      .||..||
Zfish   202 TKHDVYSFSIVIWGILTQKKPYQGENNILHIMVKVVKGVRPDLSLIPRSRPQACSGFLSLMQKCW 266

  Fly   251 KTVPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTK---ESDGTVAAQPDSLSSQEGE 312
            ...|:.|||.:                    |.|...:::.||   ||..:|:::|        |
Zfish   267 AQSPQARPSFE--------------------EITSEAEELCTKPHEESRASVSSEP--------E 303

  Fly   313 LSPSSTQLTPTTAANANVNAIAISKTTTSSMTENTSSTSSDITPTNSG---QLDNNPLFYMVTNR 374
            .||     .|..|::...|.....:..::.:.|...|.|..:|..:||   .|.|          
Zfish   304 CSP-----CPAPASSEQTNDQKPVRPKSAMLPEKDYSLSELLTQIDSGFSRSLSN---------- 353

  Fly   375 WDAIPEEESNESRNDSFNLTSSAEATQRLETIRNGMILMACKPMEQLTLDVEANGFDLSPSESSS 439
                .:|||.||::::         ::||..|.:  :..|......:||     .||...:.:.|
Zfish   354 ----VQEESLESKDNT---------SKRLSGISS--VDSAFSSQGSITL-----SFDKENAVNDS 398

  Fly   440 SSTNAK 445
            |....|
Zfish   399 SELQKK 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 82/268 (31%)
STKc_TAK1 25..275 CDD:270960 80/273 (29%)
ripk4NP_998243.1 STKc_RIP4_like 25..291 CDD:270927 86/296 (29%)
TyrKc 26..279 CDD:197581 82/283 (29%)
ANK 434..554 CDD:238125
ANK repeat 434..464 CDD:293786
Ank_2 438..531 CDD:289560
ANK repeat 467..498 CDD:293786
ANK 495..621 CDD:238125
ANK repeat 500..531 CDD:293786
Ank_2 505..595 CDD:289560
ANK repeat 534..564 CDD:293786
ANK repeat 566..598 CDD:293786
ANK 595..720 CDD:238125
ANK repeat 600..629 CDD:293786
Ank_2 605..697 CDD:289560
ANK repeat 633..664 CDD:293786
ANK repeat 666..697 CDD:293786
Ank_2 671..759 CDD:289560
ANK repeat 699..731 CDD:293786
ANK 728..>759 CDD:238125
ANK repeat 733..758 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.