DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and LOC405768

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001353900.1 Gene:LOC405768 / 405768 -ID:- Length:477 Species:Danio rerio


Alignment Length:394 Identity:122/394 - (30%)
Similarity:195/394 - (49%) Gaps:47/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LDALQAAYVD--FSEITLREKVGHGSYGVVCKAVW--RDKLVAVKEFFASAEQKDIEKEVKQLSR 66
            :.:|.|::|.  |.:|...|..|.||:|.|.:|.|  :||.||||:..      .|:.|.:.||.
Zfish    32 MSSLSASFVQIPFDDIRFYENCGGGSFGSVYRAHWVPQDKEVAVKKLL------KIDAEAEILSV 90

  Fly    67 VKHPNIIALHGISSYQQATY-LIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHA 130
            :.|.|||..:| :..:...| ::.|:|..|||:.:|.........:...|:||.:.|:|:.||||
Zfish    91 LSHKNIIQFYG-AILEAPNYGIVTEYASRGSLYEYLSSADSEEMDMDQVMTWAMEIAKGMHYLHA 154

  Fly   131 MTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNR---GSAAWMAPEVFEGSKYTE 192
            ..|..:||||:|..|::|| ....|||||||  |.|....|.:.   |:..||||||.:....:|
Zfish   155 EAPLKVIHRDLKSRNVVLT-ADNVLKICDFG--ASKMVSHTTHMSLVGTFPWMAPEVIQSLPVSE 216

  Fly   193 KCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDR 257
            .||.:|:.:||||:|:|:.||||.:........:.|.|||.:.::||....|||..||...|::|
Zfish   217 TCDTYSYGVVLWEMLTREVPFKGFEGLQVAWLVVEKHERPTIPSSCPASFADLMRRCWNAEPKER 281

  Fly   258 PSMQYIVGVMHEIVKDYTGADKA-------------LEYTF-----VNQQIVTKESDGTVAAQPD 304
            |..:.|:..:..:..|....|:.             :|.|.     :.:::..||.:  :..:..
Zfish   282 PQFKQILSTLETMKNDSKLPDQCNSFLHNKAEWRCEIEETLERLKQLERELSCKEQE--LEERER 344

  Fly   305 SLSSQEGELSPSSTQLTPTTAANANVNAIAISKTTTS----SMTE-NTSSTSSDITPT-NSGQLD 363
            .|:..|..|...|...||..   ::::.:|.:.:..|    .|.| |:|..|..|:.: ::|.|.
Zfish   345 RLTEWENRLMERSRSCTPLF---SHISPLAATLSAESFYEAHMEESNSSEVSCQISSSCSNGDLG 406

  Fly   364 NNPL 367
            .:.|
Zfish   407 QSSL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 94/250 (38%)
STKc_TAK1 25..275 CDD:270960 94/255 (37%)
LOC405768NP_001353900.1 STKc_MLTK 53..294 CDD:270962 93/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.