DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Mos

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:230 Identity:65/230 - (28%)
Similarity:103/230 - (44%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKEVKQLSRVKHPNIIALHGISSYQQATYLIM 89
            :|.|:||.|.||::||:.||||...|.| ...:..| ..|..::|.||:.|..:.|......:||
  Fly    28 LGRGAYGTVFKAIYRDRSVAVKIIRAQA-ASTLHNE-SHLLNLEHRNIVRLLKLESAADFGLVIM 90

  Fly    90 EFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKPLNLLL------ 148
            |...|.||...:.....|   |.|.:.........|.|.|:..   ::|.||||.|:|:      
  Fly    91 ECPRGQSLQRIVDTLALP---LMHRVLITLDVVAALRYCHSQN---VLHLDVKPTNILVALGTKS 149

  Fly   149 ----------TNKGRNLKICDFGTVADKSTMM-----TNNRGSAAWMAPEVFEGSKYTEKCDIFS 198
                      ..:....|:||||:..:.....     :..:|:..:|:||.......||..||:|
  Fly   150 SITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQEPSVAKGTLRYMSPEALRSDTLTEASDIYS 214

  Fly   199 WAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPP 233
            ..|.:|::.:|:.|:..:|...||.:::.|.|..|
  Fly   215 LGITMWQLQARRLPYHTLDCNETIAYQVVKHELRP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 65/230 (28%)
STKc_TAK1 25..275 CDD:270960 65/230 (28%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 65/230 (28%)
S_TKc 26..257 CDD:214567 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.