DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and CG8173

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_573239.1 Gene:CG8173 / 32753 FlyBaseID:FBgn0030864 Length:398 Species:Drosophila melanogaster


Alignment Length:242 Identity:61/242 - (25%)
Similarity:96/242 - (39%) Gaps:47/242 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LREKVGHGSYGV------------VCKAVWRDKLVAVKEFFASAE-QKD------IEKEVKQLSR 66
            :.:.:|||: |:            ..::.|     |||....:.. :||      |..|...|.:
  Fly    30 MMKTLGHGT-GIRVYRLDRSPRLGEIRSPW-----AVKRITQNMRVKKDTLFNERIVHEADILRK 88

  Fly    67 VKHPNIIALHG-ISSYQQATYLIMEFAEG--GSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYL 128
            :|||||:...| |::.:....|.:|....  ||:....|.:........|........|:.|.:|
  Fly    89 LKHPNIVGFRGVITNDEGINTLALEMCTTSLGSILEERHDEDLGPLPAKHTYKMIMDVAQALDFL 153

  Fly   129 HAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNN---------RGSAAWMAPEV 184
            |  ....|:|.|:|..|:|:..:....|:||||...........|         .|:..|.||||
  Fly   154 H--NEAHLMHGDLKSFNVLVKGEFEICKLCDFGVSLPLDEQGEVNFLKNPGLRYVGTNLWCAPEV 216

  Fly   185 F-EGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGE 230
            . |......|.||||:.:|::|.|:...|       :|::.....||
  Fly   217 IDEVDVIDSKADIFSFGLVIYETLALVPP-------HTLELDAALGE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 61/242 (25%)
STKc_TAK1 25..275 CDD:270960 61/238 (26%)
CG8173NP_573239.1 PKc_like 28..389 CDD:304357 61/242 (25%)
S_TKc 30..>245 CDD:214567 57/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.