DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Takl1

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster


Alignment Length:405 Identity:136/405 - (33%)
Similarity:211/405 - (52%) Gaps:38/405 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREK-VGHGSYGVVCKAVWRDKLVAVK--EFFASAEQKDIEKEVKQLSRVKHPNIIAL 75
            |||:|:.|.|| :|.||.|.|.||.::::.:|||  :|.....:|:.|:|:..||.:.|.|:|.:
  Fly     5 VDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVKIFDFLEETIKKNAEREITHLSEIDHENVIRV 69

  Fly    76 HGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRD 140
            .|.:|..:..||:||:.|.|||||:|:|..|..|::..|:.||.|||:.|||||:: .:|::|||
  Fly    70 IGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSL-DRPIVHRD 133

  Fly   141 VKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWMAPEVFEGSKYTEKCDIFSWAIVLWE 205
            :||.|:||.|:..:|||||||...|.|...|:.:|:..:||||..:..|||.|||::|:.|:|||
  Fly   134 IKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQGTLRYMAPEAIKHLKYTAKCDVYSFGIMLWE 198

  Fly   206 VLSRKQPFKGIDN---AYTIQWKIYKGERPPL---LTTCPKRIEDLMTACWKTVPEDRPSMQYIV 264
            :::|:.|:..::|   .|.|...|..||:.|:   .:.||:.|:.||..|....||.||||:.|.
  Fly   199 LMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLMECCMDINPEKRPSMKEIE 263

  Fly   265 GVMHEIVKDYTGAD--KALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQLTPTTAAN 327
            ..:.|..:..|..|  |.|:...|.......:|.|:...:.|....|    .||.....|.....
  Fly   264 KFLGEQYESGTDEDFIKPLDEDTVAVVTYHVDSSGSRIMRVDFWRHQ----LPSIRMTFPIVKRE 324

  Fly   328 ANVNAIAISKTTTSSMTENTSSTSSDITPTNSGQLDNNPLFYMVTNRWDAIPEEESNESRNDSFN 392
            |.    .:.||....|.:..:....::                  .|.:...|.|::.:.::...
  Fly   325 AE----RLGKTVVREMAKAAADGDREV------------------RRAEKDTERETSRAAHNGER 367

  Fly   393 LTSSAEATQRLETIR 407
            .|..|......||:|
  Fly   368 ETRRAGQDVGRETVR 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 106/253 (42%)
STKc_TAK1 25..275 CDD:270960 105/257 (41%)
Takl1NP_732554.1 S_TKc 15..262 CDD:214567 104/247 (42%)
STKc_TAK1 17..274 CDD:270960 105/257 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444230
Domainoid 1 1.000 140 1.000 Domainoid score I1532
eggNOG 1 0.900 - - E2759_KOG0192
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346131at33208
OrthoFinder 1 1.000 - - FOG0000676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.