DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Raf

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001096867.3 Gene:Raf / 31221 FlyBaseID:FBgn0003079 Length:739 Species:Drosophila melanogaster


Alignment Length:332 Identity:90/332 - (27%)
Similarity:158/332 - (47%) Gaps:51/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EITLREKVGHGSYGVVCKAVWRDKLVAVKEFF----ASAEQKDIEKEVKQLSRVKHPNIIALHGI 78
            ||.:..::|.||:|.|.:|.|... ||||...    :.|:.:..:.||..|.:.:|.||:...|.
  Fly   428 EILIGPRIGSGSFGTVYRAHWHGP-VAVKTLNVKTPSPAQLQAFKNEVAMLKKTRHCNILLFMGC 491

  Fly    79 SSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKP 143
            .| :.:..::.::.||.||:..:|.. :..:.|...:...||.|:|:.||||   |.:||||:|.
  Fly   492 VS-KPSLAIVTQWCEGSSLYKHVHVS-ETKFKLNTLIDIGRQVAQGMDYLHA---KNIIHRDLKS 551

  Fly   144 LNLLLTNKGRNLKICDFGTVADKSTMMTNNR-----GSAAWMAPEVF---EGSKYTEKCDIFSWA 200
            .|:.| ::..::||.|||....|:......:     ||..||||||.   |.:.|:.:.|::::.
  Fly   552 NNIFL-HEDLSVKIGDFGLATAKTRWSGEKQANQPTGSILWMAPEVIRMQELNPYSFQSDVYAFG 615

  Fly   201 IVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPP----LLTTCPKRIEDLMTACWKTVPEDRPSMQ 261
            ||::|:|:...|:..|.|...|.:.:.:|...|    :.:..|:.::.|...|.|..|:|||..:
  Fly   616 IVMYELLAECLPYGHISNKDQILFMVGRGLLRPDMSQVRSDAPQALKRLAEDCIKYTPKDRPLFR 680

  Fly   262 YIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQ----EGELSPSSTQLTP 322
            .::.::..:::......::                   |::|:...||    |....||     |
  Fly   681 PLLNMLENMLRTLPKIHRS-------------------ASEPNLTQSQLQNDEFLYLPS-----P 721

  Fly   323 TTAANAN 329
            .|..|.|
  Fly   722 KTPVNFN 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 78/260 (30%)
STKc_TAK1 25..275 CDD:270960 77/265 (29%)
RafNP_001096867.3 RBD_RAF 142..212 CDD:340514
C1_Raf 221..269 CDD:410361
STKc_Raf 435..687 CDD:270964 77/258 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445239
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.