DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Map3k21

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_008770896.3 Gene:Map3k21 / 307950 RGDID:1306091 Length:996 Species:Rattus norvegicus


Alignment Length:363 Identity:111/363 - (30%)
Similarity:176/363 - (48%) Gaps:86/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK------EFFASAEQKDIEKEVKQLSRVKHPN 71
            :|||..:.|:|.:|.|.:|.|.:|.|:.:.||||      |..|:|..:.:.:|.:..:.::|||
  Rat   104 HVDFERLELKELIGAGGFGQVYRATWQGQEVAVKAARRDPEQDAAAAAESVRREARLFAMLRHPN 168

  Fly    72 IIALHGISSYQQATYLIMEFAEGGSLHNFLHG--------------KVKPAYSLAHAM-SWARQC 121
            ||.|.|:...|....|::|||.||:|:..|..              ::.|     |.: :||.|.
  Rat   169 IIQLRGVCLQQPHLCLVLEFARGGALNRALAAAAPDPRVPGPRRARRIPP-----HVLVNWAVQI 228

  Fly   122 AEGLAYLHAMTPKPLIHRDVKPLNLLLTNK-------GRNLKICDFGTVAD--KSTMMTNNRGSA 177
            |.|:.|||.....|::|||:|..|:||..|       .:.|||.|||...:  ::|.| :..|:.
  Rat   229 ARGMLYLHEEAVVPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTTRM-SAAGTY 292

  Fly   178 AWMAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGID----------NAYTIQWKIYKGERP 232
            |||||||...|.:::..||:|:.::|||:|:.:.|::|||          |..|:          
  Rat   293 AWMAPEVIRSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTL---------- 347

  Fly   233 PLLTTCPKRIEDLMTACWKTVPEDRPSMQYIVGVM----------------HEIVKDYTGADKAL 281
            |:.:|||:....||..||:..|..|||...|:..:                |.:.:|:     .|
  Rat   348 PIPSTCPEPFAKLMKECWEQDPHIRPSFALILKQLTAIEEAVLTDLPQESFHSMQEDW-----KL 407

  Fly   282 EYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQ 319
            |...:..::.|||.:         |.|:|.|||.::.|
  Rat   408 EIQQMFSELRTKEKE---------LRSREEELSRAALQ 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 93/284 (33%)
STKc_TAK1 25..275 CDD:270960 94/305 (31%)
Map3k21XP_008770896.3 SH3 28..84 CDD:418401
STKc_MLK4 115..385 CDD:271048 92/285 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.