DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Dstyk

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_955750.1 Gene:Dstyk / 304791 RGDID:735051 Length:927 Species:Rattus norvegicus


Alignment Length:269 Identity:77/269 - (28%)
Similarity:123/269 - (45%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LREKVGHGSYGVV--CKAVWRDKLVAVKEFFASAEQK---DIEKEVKQL-SRVKHPNIIALHG-I 78
            |.:::|.|.||||  |.. |........:.....::|   |:..|...: |..||..::.||| :
  Rat   652 LGQELGRGQYGVVYLCDN-WGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHGSV 715

  Fly    79 SSYQQ------ATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLI 137
            ..|..      |..||||     .||..|:..:|...||...:..|....||:.:||:   :.|:
  Rat   716 IDYNYGGGSSVAVLLIME-----RLHRDLYTGLKAGLSLETRLQIALDVVEGIRFLHS---QGLV 772

  Fly   138 HRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWMAPEVFEGSKYTEKCDIFSWAIV 202
            |||:|..|:||..:.| .||.|.|....::.|..:..|:...||||:|.| ||....|::::.|:
  Rat   773 HRDIKLKNVLLDKQNR-AKITDLGFCKPEAMMSGSIVGTPIHMAPELFTG-KYDNSVDVYAFGIL 835

  Fly   203 LWEVLSRK----QPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQYI 263
            .|.:.|..    :.|:...:...:...:.:|.||..|....:....||.|||...|..||    :
  Rat   836 FWYICSGSIKLPEAFERCASKDHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPSKRP----L 896

  Fly   264 VGVMHEIVK 272
            :|::..|::
  Rat   897 LGIVQPILR 905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 75/259 (29%)
STKc_TAK1 25..275 CDD:270960 76/265 (29%)
DstykNP_955750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PKc_Dusty 649..910 CDD:270877 77/269 (29%)
S_TKc 651..895 CDD:214567 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.