DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Pbk

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001073406.1 Gene:Pbk / 290326 RGDID:1309565 Length:337 Species:Rattus norvegicus


Alignment Length:292 Identity:74/292 - (25%)
Similarity:125/292 - (42%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EKVGHGSYGV-----------VCKAVWRDKLV--AVKEFFASAEQKDIEKEVKQLSRVKHPNIIA 74
            :|:|.|: ||           :..:.|..|.:  ...:.:.:..||.:..|.|.|..:.||||: 
  Rat    36 QKLGFGT-GVSVYLMKRSPRGLSHSPWAVKKINPLCDDHYRTVYQKRLTDEAKILKNLNHPNIV- 98

  Fly    75 LHGISSYQQAT----YLIMEFAEGGSLHNFLHGKVKPA---YSLAHAMSWARQCAEGLAYLHAMT 132
              |..::.:|:    .|.||:....||::.:..:.|.:   :..|..:..|...|.||.|||  .
  Rat    99 --GYRAFTEASDGSLCLAMEYGGEKSLNDLIEERNKDSGSPFPAAVILRVALHMARGLKYLH--Q 159

  Fly   133 PKPLIHRDVKPLNLLLTNKGRNLKICDFGT--VADKSTMMTNNR----GSAAWMAPEVF-EGSKY 190
            .|.|:|.|:|..|:::......:||||.|.  ..|::..:|:..    |:..|...|.. |....
  Rat   160 EKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGII 224

  Fly   191 TEKCDIFSWAIVLWEVLSRKQPFKGI-----------------DNAYTIQWKIYK--GERPPL-- 234
            |:|.|:|::.:.|||:::...|...:                 |.||      |.  |.||.:  
  Rat   225 TDKADMFAFGLTLWEMMTLCIPHINLPDDDDDEDATFDESDFDDEAY------YAALGTRPSINM 283

  Fly   235 --LTTCPKRIEDLMTACWKTVPEDRPSMQYIV 264
              |....:::.:|...|....|:||||..:||
  Rat   284 EELDESYQKVIELFCVCTNEDPKDRPSAAHIV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 72/290 (25%)
STKc_TAK1 25..275 CDD:270960 73/290 (25%)
PbkNP_001073406.1 PKc_TOPK 32..319 CDD:270903 74/292 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.