DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Map3k10

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:XP_017177776.1 Gene:Map3k10 / 269881 MGIID:1346879 Length:991 Species:Mus musculus


Alignment Length:323 Identity:103/323 - (31%)
Similarity:161/323 - (49%) Gaps:54/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK--------EFFASAEQKDIEKEVKQLSRVKHP 70
            :.|.|:.|.|.:|.|.:|.|.:||||.:.||||        :...:|||  :.:|.:....::||
Mouse    93 IPFHELQLEEIIGVGGFGKVYRAVWRGEEVAVKAARLDPERDPAVTAEQ--VRQEARLFGALQHP 155

  Fly    71 NIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKP 135
            |||||.|.........|:||:|.||:|...|.|:..|.:.|   ::||.|.|.|:.|||...|.|
Mouse   156 NIIALRGACLSPPNLCLVMEYARGGALSRVLAGRRVPPHVL---VNWAVQVARGMNYLHNDAPVP 217

  Fly   136 LIHRDVKPLNLLLTNKGRN-------LKICDFGTVAD--KSTMMTNNRGSAAWMAPEVFEGSKYT 191
            :||||:|.:|:|:.....|       |||.|||...:  |:|.| :..|:.|||||||...|.::
Mouse   218 IIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKM-SAAGTYAWMAPEVIRLSLFS 281

  Fly   192 EKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERP-PLLTTCPKRIEDLMTA------- 248
            :..|::|:.::|||:|:.:.|::.|| |..:.:.:...:.. |:.:|||:....|:..       
Mouse   282 KSSDVWSFGVLLWELLTGEVPYREID-ALAVAYGVAMNKLTLPIPSTCPEPFARLLEGEPGPCGE 345

  Fly   249 -CWKTVPEDRPSMQYIVGVM----------------HEIVKDYTGADKALEYTFVNQQIVTKE 294
             ||...|..||....|:..:                |.:.:|:     .||...:...:.|||
Mouse   346 ECWDPDPHGRPDFGSILKQLEVIEQSALFQMPLESFHSLQEDW-----KLEIQHMFDDLRTKE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 93/270 (34%)
STKc_TAK1 25..275 CDD:270960 94/291 (32%)
Map3k10XP_017177776.1 SH3_MLK1-3 20..76 CDD:212992
PKc_like 103..368 CDD:389743 92/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.