DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and ABL1

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_009297.2 Gene:ABL1 / 25 HGNCID:76 Length:1149 Species:Homo sapiens


Alignment Length:522 Identity:130/522 - (24%)
Similarity:215/522 - (41%) Gaps:119/522 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SEITLREKVGHGSYGVVCKAVWR--DKLVAVKEFFA-SAEQKDIEKEVKQLSRVKHPNIIALHGI 78
            ::||::.|:|.|.||.|.:.||:  ...||||.... :.|.::..||...:..:||||::.|.|:
Human   259 TDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGV 323

  Fly    79 SSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIHRDVKP 143
            .:.:...|:|.||...|:|.::|....:...:....:..|.|.:..:.||.   .|..||||:..
Human   324 CTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLE---KKNFIHRDLAA 385

  Fly   144 LNLLLTNKGRN--LKICDFGTVADKSTMMTNNRGSA--------AWMAPEVFEGSKYTEKCDIFS 198
            .|.|:   |.|  :|:.|||.    |.:||.:..:|        .|.|||....:|::.|.|:::
Human   386 RNCLV---GENHLVKVADFGL----SRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWA 443

  Fly   199 WAIVLWEVLS-RKQPFKGID--NAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSM 260
            :.::|||:.: ...|:.|||  ..|.:..|.|:.|||   ..||:::.:||.|||:..|.|||| 
Human   444 FGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP---EGCPEKVYELMRACWQWNPSDRPS- 504

  Fly   261 QYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSSTQL----T 321
                                  :..::|...|...:.:::.:.:....::|.....||.|    .
Human   505 ----------------------FAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPEL 547

  Fly   322 PTTAANANVNAIAISKTTTS-SMTENTSSTSSDITPTNSGQLDNNPLFY------MVTNRWDAIP 379
            ||             ||.|| ...|:..:|.....|.:.||.:::||.:      ::..:....|
Human   548 PT-------------KTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPP 599

  Fly   380 EEESNES-----RNDSFNLTSSAEATQRLETIRNGMILMACKPMEQLTLDVEANGF---DLSPSE 436
            |...||.     ::...||.|:               |:..|.....|....::.|   |..|..
Human   600 EGGLNEDERLLPKDKKTNLFSA---------------LIKKKKKTAPTPPKRSSSFREMDGQPER 649

  Fly   437 SSSSSTNAK--SDGRERLTVTDT-------KPVMMTTDLSNNNGGIHAHSNGLLSHANGWQARDE 492
            ..:.....:  |:|....|..||       ||        :|..|:   .||.|..:.|...|..
Human   650 RGAGEEEGRDISNGALAFTPLDTADPAKSPKP--------SNGAGV---PNGALRESGGSGFRSP 703

  Fly   493 EL 494
            .|
Human   704 HL 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 83/260 (32%)
STKc_TAK1 25..275 CDD:270960 80/265 (30%)
ABL1NP_009297.2 SH3_Abl 84..137 CDD:212784
SH2_ABL 142..235 CDD:198189
PTKc_Abl 254..516 CDD:270645 85/292 (29%)
Pkinase_Tyr 261..512 CDD:285015 84/286 (29%)
FABD 1025..1149 CDD:197885
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.