DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Mos

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_064487.3 Gene:Mos / 24559 RGDID:3103 Length:342 Species:Rattus norvegicus


Alignment Length:297 Identity:74/297 - (24%)
Similarity:141/297 - (47%) Gaps:44/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEF-----FASAEQKDIEKEVKQLSRVKHPNI 72
            ::|:.::.|..::|.|.:|.|.||.:....||:|:.     ...|.|:....|: .::|:.|.||
  Rat    56 FIDWGQVCLLHRLGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRSFWAEL-NIARLHHDNI 119

  Fly    73 IALHGIS------SYQQATYLIMEFAEGGSLHNFLHG--------KVKPAYSLAHAMSWARQCAE 123
            :.:...|      |....| :||||....:||..::|        ..:...||...:.::.....
  Rat   120 VRVVAASTRTPEGSNSLGT-IIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLDIVN 183

  Fly   124 GLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFG------TVADKSTMMTNNRGSAAWMAP 182
            ||.:||:.:   ::|.|:||.|:|::.|. ..||.|||      .:..:...:.:..|:....||
  Rat   184 GLLFLHSQS---ILHLDLKPANILISEKD-VCKISDFGCSQKLQDLRCRQASLHHIGGTYTHQAP 244

  Fly   183 EVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLL-------TTCPK 240
            |:.:|...|.|.||:|:.|.||::.:|:.|:.| :..| :|:.:......|.|       :...|
  Rat   245 ELLKGEIATPKADIYSFGITLWQMTTREVPYSG-EPQY-VQYAVVAYNLRPSLAGAVFTASLTGK 307

  Fly   241 RIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGA 277
            .:::::.:||:.....||..:    ::.:.:|.:.||
  Rat   308 TLQNIVQSCWEARALQRPGAE----LLQKDLKAFRGA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 70/276 (25%)
STKc_TAK1 25..275 CDD:270960 70/281 (25%)
MosNP_064487.3 STKc_Mos 58..329 CDD:270881 71/282 (25%)
S_TKc 64..331 CDD:214567 70/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.