DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and MLKL

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_689862.1 Gene:MLKL / 197259 HGNCID:26617 Length:471 Species:Homo sapiens


Alignment Length:269 Identity:70/269 - (26%)
Similarity:121/269 - (44%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ITLREKVGHGSYGVVCKAVWRDKLVAVKEF------FASAEQKDIEKEVKQLSRVKHPNIIALHG 77
            |.|||    .....:.|..:....||:|.|      ..:..::...||:|.:.:.:.|||:.:.|
Human   207 ILLRE----NEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFG 267

  Fly    78 ISSYQQAT----YLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIH 138
            |...:..|    .::||:.|.|:|...|..  :...:|...|......|.||..|| .:..|.:|
Human   268 ICIDETVTPPQFSIVMEYCELGTLRELLDR--EKDLTLGKRMVLVLGAARGLYRLH-HSEAPELH 329

  Fly   139 RDVKPLNLLLTNKGRNLKICDF-----------GTVADKSTMMTNNRGSAAWMAPEVFEG--SKY 190
            ..::..|.|:| :|..:|:..|           ||..:|    |:...|.|:::|:..|.  .:|
Human   330 GKIRSSNFLVT-QGYQVKLAGFELRKTQTSMSLGTTREK----TDRVKSTAYLSPQELEDVFYQY 389

  Fly   191 TEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPE 255
            ..|.:|:|:.|||||:.:...||:|.::....:....|.::.||...||..:.:::..|....|.
Human   390 DVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPS 454

  Fly   256 DRPSMQYIV 264
            .|||:..|:
Human   455 VRPSVDEIL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 69/267 (26%)
STKc_TAK1 25..275 CDD:270960 66/263 (25%)
MLKLNP_689862.1 N-terminal bundle and brace (NBB), mediates INSP6 binding. /evidence=ECO:0000269|PubMed:29883610 1..149
PHA02988 177..469 CDD:165291 70/269 (26%)
PKc_like 215..466 CDD:304357 66/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.