DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and F57B9.8

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_498511.1 Gene:F57B9.8 / 175967 WormBaseID:WBGene00018999 Length:444 Species:Caenorhabditis elegans


Alignment Length:346 Identity:87/346 - (25%)
Similarity:161/346 - (46%) Gaps:58/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QAAYVDFSEITLREKVGHGSYGVVCKAVWRDKL-----------VAVK----EFFASAEQKDIEK 59
            |:..::.::||:.:.:|.|::|.|       ||           ||:|    |.....:.|:|..
 Worm   106 QSWELNHADITMTKVLGEGAFGEV-------KLGTLKMGSTTVDVAIKVAKLEKVTKEQIKEIIT 163

  Fly    60 EVKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWAR----- 119
            |.:.:....|.|::..:|:::..:...::||...||:|..:|...        .::.|..     
 Worm   164 EARLMRGFDHKNVVKCYGVAAIDEPLLVVMELVPGGALDKYLQKN--------SSVQWPEKLDII 220

  Fly   120 -QCAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNL-KICDFG--TVADKSTMMTNNRGSAAWM 180
             |.|.||||:|:   |.:||||:...|:|.   |:.: |:.|||  .|..:..|..:.|....|:
 Worm   221 AQVAAGLAYIHS---KNIIHRDIAARNILY---GKGVAKVSDFGLSRVGTEYQMDPSKRVPIRWL 279

  Fly   181 APEVFEGSKYTEKCDIFSWAIVLWEVLSR-KQPFKGIDNAYTIQWKIYKGE-RPPLLTTCPKRIE 243
            :||......||.:.|:|:::|:.|||:.. .||:..: ....:..|:.:.: |.|:....|..:.
 Worm   280 SPETIVSFLYTPQTDVFAFSILCWEVIENGAQPYPEM-LVVQVHQKVGRDDYRMPISQKAPAMLA 343

  Fly   244 DLMTACWKTVPEDRPSMQYIVGVMHEIV--KDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSL 306
            |::..||...|:.||:|..:|.:|:||.  ||.|..:|:     ..|......|.|.::   |.:
 Worm   344 DVIKKCWIRDPQQRPTMSQVVQMMYEITGKKDKTSVNKS-----TGQLRAKMMSTGPMS---DPM 400

  Fly   307 SSQEGELSPSSTQLTPTTAAN 327
            ..:..:.:....:..|::|:|
 Worm   401 RDKTAKKTGRRNKKKPSSASN 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 71/270 (26%)
STKc_TAK1 25..275 CDD:270960 75/277 (27%)
F57B9.8NP_498511.1 SH2_Fps_family 1..91 CDD:198224
STYKc 115..367 CDD:214568 72/273 (26%)
PTKc 119..367 CDD:270623 70/269 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.