DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and Mos

DIOPT Version :9

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_064405.2 Gene:Mos / 17451 MGIID:97052 Length:343 Species:Mus musculus


Alignment Length:300 Identity:75/300 - (25%)
Similarity:140/300 - (46%) Gaps:52/300 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEF-----FASAEQKDIEKEVKQLSRVKHPNII 73
            :|:.::.|..::|.|.:|.|.||.:....||:|:.     ...|.|:....|: .::|::|.||:
Mouse    58 IDWEQVCLMHRLGSGGFGSVYKATYHGVPVAIKQVNKCTKDLRASQRSFWAEL-NIARLRHDNIV 121

  Fly    74 ALHGIS------SYQQATYLIMEFAEGGSLHNFLHG--------KVKPAYSLAHAMSWARQCAEG 124
            .:...|      |....| :||||....:||..::|        ..:...||...:.::.....|
Mouse   122 RVVAASTRTPEDSNSLGT-IIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLDVVNG 185

  Fly   125 LAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNR----------GSAAW 179
            |.:||:.:   ::|.|:||.|:|::.:. ..||.|||.    |..:.:.|          |:...
Mouse   186 LLFLHSQS---ILHLDLKPANILISEQD-VCKISDFGC----SQKLQDLRCRQASPHHIGGTYTH 242

  Fly   180 MAPEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLL-------TT 237
            .|||:.:|...|.|.||:|:.|.||::.:|:.|:.| :..| :|:.:......|.|       :.
Mouse   243 QAPEILKGEIATPKADIYSFGITLWQMTTREVPYSG-EPQY-VQYAVVAYNLRPSLAGAVFTASL 305

  Fly   238 CPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGA 277
            ..|.:::::.:||:.....||..:    ::...:|.:.||
Mouse   306 TGKTLQNIIQSCWEARALQRPGAE----LLQRDLKAFRGA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 71/280 (25%)
STKc_TAK1 25..275 CDD:270960 71/285 (25%)
MosNP_064405.2 STKc_Mos 59..335 CDD:270881 72/291 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0192
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.