DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tak1 and FPGT-TNNI3K

DIOPT Version :10

Sequence 1:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster
Sequence 2:NP_001106279.3 Gene:FPGT-TNNI3K / 100526835 HGNCID:42952 Length:936 Species:Homo sapiens


Alignment Length:317 Identity:100/317 - (31%)
Similarity:157/317 - (49%) Gaps:39/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFAS--AEQKDIE---KEVKQLSRVKHPNI 72
            ::..|||...|.:|.||:|.|.|...|:|:||:|.:.|:  ..:.|::   :||..|.::.||.:
Human   558 HLQLSEIEFHEIIGSGSFGKVYKGRCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCQLNHPCV 622

  Fly    73 IALHGISSYQQATY-LIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPL 136
            |...|......:.: ::.::..||||.:.|| :.|....|...:..|...|:|:.|||.:| :|:
Human   623 IQFVGACLNDPSQFAIVTQYISGGSLFSLLH-EQKRILDLQSKLIIAVDVAKGMEYLHNLT-QPI 685

  Fly   137 IHRDVKPLNLLLTNKGRNLKICDFGTVADKSTM----MTNNRGSAAWMAPEVF-EGSKYTEKCDI 196
            ||||:...|:||...|..: :.|||......::    ||...|:..||||||| :.::||.|.|:
Human   686 IHRDLNSHNILLYEDGHAV-VADFGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADV 749

  Fly   197 FSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKRIEDLMTACWKTVPEDRPSMQ 261
            ||:|:.|||:|:.:.||..:..|.......|...|||:..:.||.|..|:...|...||.||...
Human   750 FSYALCLWEILTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLIRGWNACPEGRPEFS 814

  Fly   262 YIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVAAQPDSLSSQEGELSPSST 318
            .:|              ..||....|.::::..|           |:..|.|||||:
Human   815 EVV--------------MKLEECLCNIELMSPAS-----------SNSSGSLSPSSS 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tak1NP_524080.1 STKc_TAK1 25..275 CDD:270960 85/260 (33%)
FPGT-TNNI3KNP_001106279.3 ANKYR 155..391 CDD:440430
ANK repeat 167..199 CDD:293786
ANK repeat 201..232 CDD:293786
ANK repeat 235..265 CDD:293786
ANK repeat 267..298 CDD:293786
ANK repeat 300..333 CDD:293786
ANK repeat 335..363 CDD:293786
ANK repeat 370..403 CDD:293786
ANK repeat 405..438 CDD:293786
Ank_2 410..502 CDD:463710
ANK repeat 440..470 CDD:293786
PKc_TNNI3K 570..823 CDD:270966 87/269 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.