DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and Prdx6

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_446028.1 Gene:Prdx6 / 94167 RGDID:71005 Length:224 Species:Rattus norvegicus


Alignment Length:197 Identity:58/197 - (29%)
Similarity:92/197 - (46%) Gaps:14/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNINQVAPNFTTNAVVSGGYRNFALTDLRG-RYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVG 67
            |.:...||||..|..:  |:..|  .|..| .:.:|..:|.||:.||.|||...:..||||....
  Rat     5 LLLGDEAPNFEANTTI--GHIRF--HDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRN 65

  Fly    68 CEVLACSTDSHFVHCAWMNTPRKNGGLG---ELDIPLLADKNMKIARDYGVLD----EDTGLAL- 124
            .:::|.|.||...|.||........|..   :|..|::.||:..:|...|:||    ::.|:.: 
  Rat    66 VKLIALSIDSVEDHFAWSKDINAYNGAAPTEKLPFPIIDDKDRDLAILLGMLDPAEKDEKGMPVT 130

  Fly   125 -RALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGK 188
             |.:||...:.:::...:.....||:.||.||:|.:.|.:.......||:|:.|...|......:
  Rat   131 ARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTASNPVATPVDWKKGESVMVLPTLPE 195

  Fly   189 EE 190
            ||
  Rat   196 EE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 58/197 (29%)
PRX_Typ2cys 6..177 CDD:239313 53/180 (29%)
Prdx6NP_446028.1 AhpC 5..200 CDD:223527 58/197 (29%)
PRX_1cys 7..222 CDD:239314 57/195 (29%)
Required and sufficient for targeting to lysosomes and lamellar bodies. /evidence=ECO:0000269|PubMed:19700648 31..40 1/8 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.