DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and TSA1

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_013684.1 Gene:TSA1 / 854980 SGDID:S000004490 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:101/190 - (53%)
Similarity:132/190 - (69%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEV 70
            :.:.||.|...|||.|.:...:|...:|:||:|.|.|..|::|||||:.|||:.|.:|...|.:|
Yeast     5 VQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAKKFEEQGAQV 69

  Fly    71 LACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGR 135
            |..||||.:...||.|.|||.||||.::||||||.|..::||||||.|:.|:|||.|||||.:|.
Yeast    70 LFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGV 134

  Fly   136 IRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFKHA 195
            ||.||:||:.|||:||||||||:|||::|:.|.|.|.||.|||.|:|......:|||:.|
Yeast   135 IRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 100/187 (53%)
PRX_Typ2cys 6..177 CDD:239313 92/170 (54%)
TSA1NP_013684.1 PRX_Typ2cys 5..176 CDD:239313 92/170 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346739
Domainoid 1 1.000 161 1.000 Domainoid score I848
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I706
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 1 1.000 - - mtm9201
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.