DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and 2-Cys Prx B

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_568166.1 Gene:2-Cys Prx B / 830517 AraportID:AT5G06290 Length:273 Species:Arabidopsis thaliana


Alignment Length:189 Identity:93/189 - (49%)
Similarity:126/189 - (66%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSGGYRNFALTDLRG-RYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCE 69
            :...||:|...||....:....|::..| :||:|.|||.||::|||||:.|||||..||..:..|
plant    82 VGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRYEEFEKLNTE 146

  Fly    70 VLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREG 134
            ||..|.||.|.|.||:.|.||:||||:|:.||::|....|::.:|||..|.|:|||.|||||:||
plant   147 VLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFIIDKEG 211

  Fly   135 RIRQITVNDMGVGRSVDEALRLVQAFQFSDEF-GEVCPVNWRPGAKTMKADATGKEEYF 192
            .|:..|:|::|:||||||.:|.:||.|:..|. .||||..|:||.|:||.|....:|||
plant   212 VIQHSTINNLGIGRSVDETMRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 93/189 (49%)
PRX_Typ2cys 6..177 CDD:239313 84/172 (49%)
2-Cys Prx BNP_568166.1 PRX_Typ2cys 82..255 CDD:239313 84/172 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4585
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.