DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and PRXQ

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001189979.1 Gene:PRXQ / 822203 AraportID:AT3G26060 Length:217 Species:Arabidopsis thaliana


Alignment Length:159 Identity:46/159 - (28%)
Similarity:80/159 - (50%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNV 66
            :.:|..|.||:||   :.....:..:|...:|:.|:|.|||||.:..|..:..||.|...:|:..
plant    68 KQVNKGQAAPDFT---LKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKA 129

  Fly    67 GCEVLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTG-LALRALFII 130
            |.||:..|.|....|.|:.:..:       |...||:|:..|:.:|:||..:..| |..|..:::
plant   130 GAEVIGISGDDSASHKAFASKYK-------LPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVL 187

  Fly   131 DREGRIRQITVNDMGVGRSVDEALRLVQA 159
            |:.|.::.|..|.....:.:||.|:.::|
plant   188 DKNGVVQLIYNNQFQPEKHIDETLKFLKA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 46/158 (29%)
PRX_Typ2cys 6..177 CDD:239313 45/155 (29%)
PRXQNP_001189979.1 PRX_BCP 74..212 CDD:239315 43/147 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.