DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx2

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001002468.1 Gene:prdx2 / 791455 ZFINID:ZDB-GENE-030326-2 Length:197 Species:Danio rerio


Alignment Length:187 Identity:111/187 - (59%)
Similarity:143/187 - (76%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEV 70
            |.|.||.|...|||.|.:::..|:|.||:||:|.|||.||::|||||:.|||:||.|||.:|.|:
Zfish     8 IGQPAPQFKATAVVDGQFKDIQLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSERAAEFRKIGVEL 72

  Fly    71 LACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGR 135
            :|.||||||.|.||:|||||.||||.::|||:||....|:||||||.||.|:|.|.||:||.:|.
Zfish    73 IAASTDSHFSHLAWINTPRKQGGLGSMNIPLVADLTQSISRDYGVLKEDEGIAYRGLFVIDDKGI 137

  Fly   136 IRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYF 192
            :||||:||:.|||||||.||||||||.:|::|||||..|:||:.|:..|....:|:|
Zfish   138 LRQITINDLPVGRSVDETLRLVQAFQHTDKYGEVCPAGWKPGSDTIVPDVQKSKEFF 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 111/187 (59%)
PRX_Typ2cys 6..177 CDD:239313 105/170 (62%)
prdx2NP_001002468.1 PTZ00253 1..195 CDD:140280 111/187 (59%)
PRX_Typ2cys 8..179 CDD:239313 105/170 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.