DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx3

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001025608.1 Gene:prdx3 / 594996 XenbaseID:XB-GENE-994377 Length:243 Species:Xenopus tropicalis


Alignment Length:188 Identity:106/188 - (56%)
Similarity:143/188 - (76%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEV 70
            :.|.||:|...|||:|.::..:|.|.:|:|::|.|||.||::|||||:.|||::|.||.:|.|||
 Frog    53 VTQHAPHFKGTAVVNGEFKELSLEDYKGKYLVLFFYPLDFTFVCPTEIVAFSNKANEFHDVNCEV 117

  Fly    71 LACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGR 135
            :|.|.||||.|.||.|||||:||||:::||||:|.|.:|:||||||.|..|:|||.|||||..|.
 Frog   118 VAVSVDSHFCHLAWTNTPRKSGGLGQMNIPLLSDLNKQISRDYGVLLETPGIALRGLFIIDPNGI 182

  Fly   136 IRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFK 193
            |:.::|||:.|||||:|.||||:||||.:..|||||.||.|.:.|:|....|.::||:
 Frog   183 IKHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPSPEGSKDYFE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 106/188 (56%)
PRX_Typ2cys 6..177 CDD:239313 100/170 (59%)
prdx3NP_001025608.1 PRX_Typ2cys 53..224 CDD:239313 100/170 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.