DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx2

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_989001.1 Gene:prdx2 / 394597 XenbaseID:XB-GENE-945852 Length:206 Species:Xenopus tropicalis


Alignment Length:188 Identity:102/188 - (54%)
Similarity:139/188 - (73%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCE 69
            :|.|.||.|...|||:|.:::..|:|..|:||:|.|||.||::|||||:.||||.|.:|..:.|:
 Frog    15 HIGQPAPAFKATAVVNGEFKDIQLSDYLGKYVVLFFYPLDFTFVCPTEIIAFSDHAGDFSKINCQ 79

  Fly    70 VLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREG 134
            ::|.|.||.|.|.||.|.|||.||||.::|||::|....||:|||||.|:.|:|.|.|||||.:|
 Frog    80 LIAVSVDSQFTHLAWTNVPRKEGGLGPINIPLVSDLTHSIAKDYGVLKEEDGVAYRGLFIIDGKG 144

  Fly   135 RIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYF 192
            .:||||:||:.|||||:|.||||||||::|:.|||||..|:||:.|:|.:....:|:|
 Frog   145 NLRQITINDLPVGRSVEETLRLVQAFQYTDQHGEVCPAGWKPGSSTIKPNVKDSKEFF 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 102/188 (54%)
PRX_Typ2cys 6..177 CDD:239313 96/170 (56%)
prdx2NP_989001.1 PRX_Typ2cys 16..187 CDD:239313 96/170 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.