DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx6

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_957099.1 Gene:prdx6 / 393778 ZFINID:ZDB-GENE-040426-1778 Length:222 Species:Danio rerio


Alignment Length:195 Identity:51/195 - (26%)
Similarity:89/195 - (45%) Gaps:14/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSG-GYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCE 69
            :..|.|||..:..:.. .:..|    |...:.:|..:|.||:.||.|||...:....||:....:
Zfish     6 LGDVFPNFEADTTIGKIKFHEF----LGNSWGILFSHPRDFTPVCTTELARAAKLHEEFKKRDVK 66

  Fly    70 VLACSTDSHFVHCAWMN---TPRKNGGLGELDIPLLADKNMKIARDYGVLDED----TGLAL--R 125
            ::|.|.||...|..|..   ...::.....:..|::||...:::...|:||.|    .|:.|  |
Zfish    67 MIALSIDSVEDHRKWSEDILAFNQDKACCPMPFPIIADDKRELSVLLGMLDPDERDKDGMPLTAR 131

  Fly   126 ALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEE 190
            .:|::..:.|::...:.....||:.||.||:|.:.|.:.......||:|:||.:.|...:...||
Zfish   132 CVFVVGPDKRLKLSILYPATTGRNFDEILRVVDSLQLTATKKVATPVDWKPGQEVMVIPSLSDEE 196

  Fly   191  190
            Zfish   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 51/195 (26%)
PRX_Typ2cys 6..177 CDD:239313 46/180 (26%)
prdx6NP_957099.1 AhpC 5..199 CDD:223527 51/195 (26%)
PRX_1cys 6..221 CDD:239314 51/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.