DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx3

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001013478.3 Gene:prdx3 / 373079 ZFINID:ZDB-GENE-030826-18 Length:250 Species:Danio rerio


Alignment Length:188 Identity:103/188 - (54%)
Similarity:139/188 - (73%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 INQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEV 70
            :.|.||:|...||::|.::..:|.|.:|:|::|.|||.||::|||||:.||||:|.||.:|.|.|
Zfish    60 VTQAAPHFKGTAVINGEFKEISLGDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCAV 124

  Fly    71 LACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGR 135
            :..|.||||.|.||.|||||:||||::.||||||...:::||||||.|..|:|||.|||||..|.
Zfish   125 VGVSVDSHFTHLAWTNTPRKSGGLGKIQIPLLADLTKQVSRDYGVLLEGPGIALRGLFIIDPNGI 189

  Fly   136 IRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFK 193
            :|.::|||:.|||||:|.||||:||||.:..|||||.:|.|.:.|:|....|.:|||:
Zfish   190 VRHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPASWTPKSPTIKPTPDGSKEYFE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 103/188 (55%)
PRX_Typ2cys 6..177 CDD:239313 96/170 (56%)
prdx3NP_001013478.3 PRX_Typ2cys 60..230 CDD:239313 96/169 (57%)
PTZ00253 64..250 CDD:140280 102/184 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.