DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and Prx2540-2

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_523683.1 Gene:Prx2540-2 / 36098 FlyBaseID:FBgn0033518 Length:220 Species:Drosophila melanogaster


Alignment Length:211 Identity:70/211 - (33%)
Similarity:96/211 - (45%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNINQVAPNF---TTNAVVSGGYRNFALTDLRGR-YVLLVFYPADFSYVCPTELQAFSDRAPEF- 63
            :.:.|..|||   ||...:.       ..:.:|. :|:|..:||||:.||.|||...:...||| 
  Fly     1 MRLGQTVPNFEADTTKGPIK-------FHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFA 58

  Fly    64 -RNVGCEVLACSTDSHFVHCAWMN--------TPRKNGGLGELDIPLLADKNMKIARDYGVLDE- 118
             ||..|  ||.|.|:...|..|:|        .|      |:...|::||....:|...|:||| 
  Fly    59 KRNTKC--LAHSVDALNSHVDWVNDIKSYCLDIP------GDFPYPIIADPTRDLAVSLGMLDEE 115

  Fly   119 -----DTGLALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVC-PVNWRPG 177
                 :.|..:||||||..:.::|......|..||:|||.||.:.:.|.:|....|. |.||.||
  Fly   116 QKKDPEVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPG 180

  Fly   178 AKTMKADATGKEEYFK 193
            .|.|.......||..|
  Fly   181 TKVMILPTVTDEEAHK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 70/211 (33%)
PRX_Typ2cys 6..177 CDD:239313 63/191 (33%)
Prx2540-2NP_523683.1 AhpC 1..194 CDD:223527 68/207 (33%)
PRX_1cys 3..218 CDD:239314 70/209 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446113
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.