DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and Prx6005

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_523463.2 Gene:Prx6005 / 33493 FlyBaseID:FBgn0031479 Length:222 Species:Drosophila melanogaster


Alignment Length:198 Identity:62/198 - (31%)
Similarity:101/198 - (51%) Gaps:14/198 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNV 66
            :.|||....||||  |..|.|..:| ...::..:.:|..:||||:.||.|||...:...|||:..
  Fly     4 KALNIGDQFPNFT--AETSEGRIDF-YDWMQDSWAILFSHPADFTPVCTTELSRVAALIPEFQKR 65

  Fly    67 GCEVLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDED----TGLAL--R 125
            |.:.:|.|.|:...|..|:...:..|.|...|.|::||...::|..:.:||:|    .|:.|  |
  Fly    66 GVKPIALSCDTVESHKGWIEDIKSFGKLSSFDYPIIADDKRELALKFNMLDKDEINAEGIPLTCR 130

  Fly   126 ALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAK-----TMKADA 185
            |:|::|.:.::|...:.....||:.||.||::.:.|.:.......|.:|:.|.|     |:||:.
  Fly   131 AVFVVDDKKKLRLSILYPATTGRNFDEILRVIDSLQLTQTKSVATPADWKQGGKCMVLPTVKAED 195

  Fly   186 TGK 188
            ..|
  Fly   196 VPK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 62/197 (31%)
PRX_Typ2cys 6..177 CDD:239313 54/176 (31%)
Prx6005NP_523463.2 PRX_1cys 8..220 CDD:239314 60/194 (31%)
AhpC 8..198 CDD:223527 59/192 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446102
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.640

Return to query results.
Submit another query.