Sequence 1: | NP_648759.1 | Gene: | CG6888 / 39658 | FlyBaseID: | FBgn0036490 | Length: | 196 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_796230.1 | Gene: | Prdx6b / 320769 | MGIID: | 1336888 | Length: | 224 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 55/202 - (27%) |
---|---|---|---|
Similarity: | 94/202 - (46%) | Gaps: | 24/202 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LNINQVAPNFTTNAVVSG-GYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVG 67
Fly 68 CEVLACSTDSHFVHCAWMN--------TPRKNGGLGELDIPLLADKNMKIARDYGVLD---EDTG 121
Fly 122 ---LALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKA 183
Fly 184 DATGKEE 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6888 | NP_648759.1 | AhpC | 3..194 | CDD:223527 | 55/202 (27%) |
PRX_Typ2cys | 6..177 | CDD:239313 | 50/185 (27%) | ||
Prdx6b | NP_796230.1 | AhpC | 5..199 | CDD:223527 | 55/202 (27%) |
PRX_1cys | 7..222 | CDD:239314 | 54/200 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0450 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100111 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.710 |