DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and Prdx6b

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_796230.1 Gene:Prdx6b / 320769 MGIID:1336888 Length:224 Species:Mus musculus


Alignment Length:202 Identity:55/202 - (27%)
Similarity:94/202 - (46%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNINQVAPNFTTNAVVSG-GYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVG 67
            |.:.:.||:|..|..:.. .:.:|    |...:.:|..:|.||:.||.|||...:..||||....
Mouse     5 LLLGEEAPDFEANTTIGRIRFHDF----LGNSWGMLFSHPKDFTPVCTTELGRAAKLAPEFAKRN 65

  Fly    68 CEVLACSTDSHFVHCAWMN--------TPRKNGGLGELDIPLLADKNMKIARDYGVLD---EDTG 121
            .:::|.|.||...|.||..        ||::     :|..|::.||:..|:..:.:||   :|..
Mouse    66 VKLIALSVDSVEDHLAWSKDINAYNGATPKE-----KLPFPIIDDKDRDISILFCMLDPVEKDAN 125

  Fly   122 ---LALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKA 183
               |..|.:||...:.:::...:.....||:.||.||::.:.|.::......||:|:.|...|..
Mouse   126 SMPLTARGVFIFGPDKKLKMSLLYPNSTGRNFDEILRVIDSLQLTETKPVATPVDWKKGESVMVL 190

  Fly   184 DATGKEE 190
            ....:||
Mouse   191 PDLPEEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 55/202 (27%)
PRX_Typ2cys 6..177 CDD:239313 50/185 (27%)
Prdx6bNP_796230.1 AhpC 5..199 CDD:223527 55/202 (27%)
PRX_1cys 7..222 CDD:239314 54/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.