DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6888 and prdx-6

DIOPT Version :9

Sequence 1:NP_648759.1 Gene:CG6888 / 39658 FlyBaseID:FBgn0036490 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_741287.1 Gene:prdx-6 / 176837 WormBaseID:WBGene00021401 Length:231 Species:Caenorhabditis elegans


Alignment Length:206 Identity:57/206 - (27%)
Similarity:88/206 - (42%) Gaps:32/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LNINQVAPNFTTNAVVSGGYRNFALTDLR---------GRYVLLVF-YPADFSYVCPTELQAFSD 58
            :.:....||||..            ||||         |...|::| :||||:.||.|||.....
 Worm     1 MKLGDTVPNFTFE------------TDLRKNQTLHNYIGEQWLMLFSHPADFTPVCTTELAELVK 53

  Fly    59 RAPEFRNVGCEVLACSTDSHFVHCAW---MNTPRKNGGLG-ELDIPLLADKNMKIARDYGVLDED 119
            .|||||....::||.|.||...|..|   :|:..:....| .|...::||.:..|..:.|::|.|
 Worm    54 LAPEFRKRHVQILAISIDSSETHRDWAKDINSVAQLSNCGSHLPFEIIADTDRSICTELGMIDPD 118

  Fly   120 ----TGLAL--RALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGA 178
                .|:.|  ||:.:...:.:::...:.....||:..|.||:|...|...:.....|.||..|.
 Worm   119 EMNSEGICLSARAVMLFGPDKKLKSKILYPATFGRNFVEILRMVDGVQLGTKAPVATPANWIAGD 183

  Fly   179 KTMKADATGKE 189
            ..:...:..:|
 Worm   184 NVIAQPSLSQE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6888NP_648759.1 AhpC 3..194 CDD:223527 57/206 (28%)
PRX_Typ2cys 6..177 CDD:239313 55/190 (29%)
prdx-6NP_741287.1 PRX_1cys 3..221 CDD:239314 57/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.