DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7011 and AT2G13440

DIOPT Version :10

Sequence 1:NP_648758.1 Gene:CG7011 / 39657 FlyBaseID:FBgn0036489 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_178974.1 Gene:AT2G13440 / 815830 AraportID:AT2G13440 Length:723 Species:Arabidopsis thaliana


Alignment Length:171 Identity:36/171 - (21%)
Similarity:58/171 - (33%) Gaps:38/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 FHFAPGKSFSIRQFHIHDFQF-----SNVKLSHTI--NHL----SFGEKIEFAKTHPLDGLRVDV 258
            |.|.|       .|||...|.     ...|::|.:  ::|    ::|..:|.........:...:
plant   294 FSFDP-------DFHIEREQMCCYLTRTTKITHQLIRDNLHETPTYGGWVEAKGPRYCPSIEDKI 351

  Fly   259 AETK-SEMFNYYL----KIVPTLYMRGNSDGEPIYTNQFSVTRYRKDLSDRERGMPGIFFSYELS 318
            ...| .|....:|    :.||.:|::|.|.|.| ...|..:.|....|.:.....|.....|:..
plant   352 VRFKDKESHQIFLEPEGRDVPEIYVQGFSTGLP-ENLQLPLLRSLPGLENCSMLRPAYAVEYDYL 415

  Fly   319 P-------LMVKYAER-------HSSFGHFATNCCSIIGGV 345
            |       ||.|..|.       :.:.|:.......||.|:
plant   416 PAHQCSRSLMTKKIEGLFFSGQINGTTGYEEAAAQGIISGI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7011NP_648758.1 ERGIC_N 7..97 CDD:464000
COPIIcoated_ERV 138..352 CDD:462327 36/171 (21%)
AT2G13440NP_178974.1 MnmG 72..692 CDD:440214 36/171 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.