DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and MGR2

DIOPT Version :9

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_015227.1 Gene:MGR2 / 856006 SGDID:S000006019 Length:113 Species:Saccharomyces cerevisiae


Alignment Length:77 Identity:31/77 - (40%)
Similarity:48/77 - (62%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGT 66
            ||| .:::||.|:.:||.|.|.::|..||:.:|.:||||:....|.....::..:||.:....||
Yeast     3 PLP-QNYAQQQPSNWDKFKMGLMMGTTVGVCTGILFGGFAIATQGPGPDGVVRTLGKYIAGSAGT 66

  Fly    67 FGTFMAIGTGIR 78
            ||.||:||:.||
Yeast    67 FGLFMSIGSIIR 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:402038 25/65 (38%)
MGR2NP_015227.1 Romo1 14..79 CDD:402038 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2868
eggNOG 1 0.900 - - E1_KOG4096
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1765
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004057
OrthoInspector 1 1.000 - - oto100210
orthoMCL 1 0.900 - - OOG6_105143
Panther 1 1.100 - - LDO PTHR28525
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R715
SonicParanoid 1 1.000 - - X3897
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.