DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and AT3G07910

DIOPT Version :10

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_566324.1 Gene:AT3G07910 / 819982 AraportID:AT3G07910 Length:74 Species:Arabidopsis thaliana


Alignment Length:66 Identity:21/66 - (31%)
Similarity:35/66 - (53%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGTFMAIGTGIR 78
            :|..|:..|..:|..:|.|.|||:|.:.|:|..:.|...:..:|:|.:.....||.|:..|:.|.
plant     5 SCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGLFLGAGSLIH 69

  Fly    79 C 79
            |
plant    70 C 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:431168 20/64 (31%)
AT3G07910NP_566324.1 Romo1 <28..70 CDD:431168 11/41 (27%)

Return to query results.
Submit another query.