DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and AT3G07910

DIOPT Version :9

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_566324.1 Gene:AT3G07910 / 819982 AraportID:AT3G07910 Length:74 Species:Arabidopsis thaliana


Alignment Length:66 Identity:21/66 - (31%)
Similarity:35/66 - (53%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGTFMAIGTGIR 78
            :|..|:..|..:|..:|.|.|||:|.:.|:|..:.|...:..:|:|.:.....||.|:..|:.|.
plant     5 SCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGLFLGAGSLIH 69

  Fly    79 C 79
            |
plant    70 C 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:402038 20/64 (31%)
AT3G07910NP_566324.1 Romo1 <28..70 CDD:402038 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105143
Panther 1 1.100 - - LDO PTHR28525
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.