powered by:
Protein Alignment CG6878 and AT3G07910
DIOPT Version :9
Sequence 1: | NP_648757.1 |
Gene: | CG6878 / 39656 |
FlyBaseID: | FBgn0036488 |
Length: | 79 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_566324.1 |
Gene: | AT3G07910 / 819982 |
AraportID: | AT3G07910 |
Length: | 74 |
Species: | Arabidopsis thaliana |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 35/66 - (53%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 TCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGTFMAIGTGIR 78
:|..|:..|..:|..:|.|.|||:|.:.|:|..:.|...:..:|:|.:.....||.|:..|:.|.
plant 5 SCLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGLFLGAGSLIH 69
Fly 79 C 79
|
plant 70 C 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG6878 | NP_648757.1 |
Romo1 |
14..79 |
CDD:402038 |
20/64 (31%) |
AT3G07910 | NP_566324.1 |
Romo1 |
<28..70 |
CDD:402038 |
11/41 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4096 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004057 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105143 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR28525 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.810 |
|
Return to query results.
Submit another query.