DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and Romo1

DIOPT Version :10

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001182419.1 Gene:Romo1 / 679572 RGDID:1587111 Length:79 Species:Rattus norvegicus


Alignment Length:79 Identity:49/79 - (62%)
Similarity:62/79 - (78%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGG 65
            ||:....:.|..|:|||::|.||::|..||||:||:||.||.||.|:|||||:..:||||:|.||
  Rat     1 MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGG 65

  Fly    66 TFGTFMAIGTGIRC 79
            |||||||||.||||
  Rat    66 TFGTFMAIGMGIRC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:431168 43/64 (67%)
Romo1NP_001182419.1 Romo1 14..79 CDD:431168 43/64 (67%)

Return to query results.
Submit another query.