DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6878 and Y94A7B.11

DIOPT Version :10

Sequence 1:NP_648757.1 Gene:CG6878 / 39656 FlyBaseID:FBgn0036488 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001123069.1 Gene:Y94A7B.11 / 6418709 WormBaseID:WBGene00050893 Length:69 Species:Caenorhabditis elegans


Alignment Length:64 Identity:17/64 - (26%)
Similarity:29/64 - (45%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGRELINNVGKTMVQGGGTFGTFMAIGTGIRC 79
            |.|::.|.::|..:|.|:..:.|||...|.|:|.::......|.........|    :..|:||
 Worm    10 FTKIRMGLMMGAMIGGATCILLGGFMGFRAGMRDKDFSYKPEKLWHNPADHLG----VAQGLRC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6878NP_648757.1 Romo1 14..79 CDD:431168 15/62 (24%)
Y94A7B.11NP_001123069.1 Romo1 8..69 CDD:431168 15/62 (24%)

Return to query results.
Submit another query.